Active Ingredient Lixisenatide
Active Ingredient Details
What is Lixisenatide?
A synthetic GLUCAGON-LIKE PEPTIDE-1 RECEPTOR (GLP-1) agonist that binds GLP-1 receptor that is used to control blood sugar levels in patients with TYPE 2 DIABETES; amino acid sequence is H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSK KKKKK-NH2 (ZP10A).
What is the usage for Lixisenatide?
Lixisenatide is used with a proper diet and exercise program to control high blood sugar in people with type 2 diabetes. Controlling high blood sugar helps prevent kidney damage, blindness, nerve problems, loss of limbs, and sexual function problems. Proper control of diabetes may also lessen your risk of a heart attack or stroke. Lixisenatide is similar to a natural hormone in your body (incretin). It works by causing insulin release in response to high sugar levels (such as after a meal) and decreasing the amount of sugar your liver makes. Lixisenatide is not a substitute for insulin if you require insulin treatment.
How many products in the NDC database contain Lixisenatide?
The NDC database has 1 products with the active ingredient Lixisenatide. The following table lists all the products that have this active ingredient.
NDC Products with Lixisenatide
| NDC | Proprietary Name | Non-Proprietary Name | Dosage Form | Route Name | Company Name | Status | |
|---|---|---|---|---|---|---|---|
| 0024-5761 | Proprietary Name: Soliqua 100/33 | Insulin Glargine And Lixisenatide | Injection, Solution | Subcutaneous | Sanofi-aventis U.s. Llc | ACTIVE |