Active Ingredient Lixisenatide

Active Ingredient Details

What is Lixisenatide?

A synthetic GLUCAGON-LIKE PEPTIDE-1 RECEPTOR (GLP-1) agonist that binds GLP-1 receptor that is used to control blood sugar levels in patients with TYPE 2 DIABETES; amino acid sequence is H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSK KKKKK-NH2 (ZP10A).

What is the usage for Lixisenatide?

Lixisenatide is used with a proper diet and exercise program to control high blood sugar in people with type 2 diabetes. Controlling high blood sugar helps prevent kidney damage, blindness, nerve problems, loss of limbs, and sexual function problems. Proper control of diabetes may also lessen your risk of a heart attack or stroke. Lixisenatide is similar to a natural hormone in your body (incretin). It works by causing insulin release in response to high sugar levels (such as after a meal) and decreasing the amount of sugar your liver makes. Lixisenatide is not a substitute for insulin if you require insulin treatment.

How many products in the NDC database contain Lixisenatide?

The NDC database has 1 products with the active ingredient Lixisenatide. The following table lists all the products that have this active ingredient.

NDC Products with Lixisenatide

NDC Proprietary Name Non-Proprietary Name Dosage Form Route Name Company Name Status
0024-5761Proprietary Name: Soliqua 100/33 Insulin Glargine And LixisenatideInjection, SolutionSubcutaneousSanofi-aventis U.s. LlcACTIVE
<